Submission Format

For CAMEO Contact Prediction a fasta file will be submitted to the registered servers. In case of hetero oligomers this will be a multiple fasta file:

>1
SEQUENCE ONE
>2
SEQUENCE TWO
>3
SEQUENCE THREE

The fasta header encodes the PDB entity id that is to be used for identifying this sequence.


Prediction Format

The prediction file has to fullfill the following format to be treated as valid:

s(equence)<id>.OLC<residue number> s(equence)<id>.OLC<residue number> minimal_distance_cutoff maximal_distance_cutoff probability

example for intra chain contacts:

s1.G116 s1.C83 0 8 0.311

example for inter chain contacts:

s1.P91 s2.E145 0 8 0.6365

Example

Submission for target corresponding to PDB id 4YC7

>1
GAMGNAGSMDSQQTDFRAHNVPLKLPMPEPGELEERFAIVLNAMNLPPDKARLLRQYDNEKKWELICDQERFQVKNPPHTYIQKLKGYLDPAVTRKKFRRRVQESTQVLRELEISLRTNHIGWVREFLNEENKGLDVLVEYLSFAQYAVTFDFESVESTVESSVDKSKPWSRSIEDLHRGSNLPSPVGNSVSRSGRHSALRYNTLPSRRTLKNSRLVSKKDDVHVCIMCLRAIMNYQYGFNMVMSHPHAVNEIALSLNNKNPRTKALVLELLAAVCLVRGGHEIILSAFDNFKEVCGEKQRFEKLMEHFRNEDNNIDFMVASMQFINIVVHSVEDMNFRVHLQYEFTKLGLDEYLDKLKHTESDKLQVQIQAYLDNVFDVG
>2
GAMQTIKCVVVGDGAVGKTCLLISYTTNKFPSEYVPTVFDNYAVTVMIGGEPYTLGLFDTAGQEDYDRLRPLSYPQTDVFLVCFSVVSPSSFENVKEKWVPEITHHCPKTPFLLVGTQIDLRDDPSTIEKLAKNKQKPITPETAEKLARDLKAVKYVECSALTQR

Valid Predictionshow all

s2.G116   s2.C83    0  8  0.3111
s2.G116   s2.F84    0  8  0.0363
s2.G116   s2.S85    0  8  0.0270
s2.L131   s1.G280   0  8  0.0260
s2.G116   s2.V86    0  8  0.0424
s2.G116   s2.A144   0  8  0.1924
s2.G116   s2.Y156   0  8  0.4257
s2.P101   s1.T347   0  8  0.4247
s2.G116   s2.V157   0  8  0.1631
s2.G116   s2.E158   0  8  0.7041
s2.G116   s2.C159   0  8  0.6375
s1.P91    s2.E145   0  8  0.6365
s1.E34    s1.N59    0  8  0.5010
s1.E34    s1.K62    0  8  0.2666
s1.E34    s1.W63    0  8  0.8375
s1.M323   s1.L216   0  8  0.8365
s1.K96    s2.E93    0  8  0.6956
s1.K96    s2.N94    0  8  0.7468
s1.K96    s2.V95    0  8  0.5952
s1.L89    s2.Y53    0  8  0.5942
s1.K96    s2.K96    0  8  0.9624
s1.K96    s2.E97    0  8  0.3228
s1.K96    s2.K98    0  8  0.2126
s2.D65    s2.L72    0  8  0.2116
s1.K96    s2.V100   0  8  0.6461
s1.K96    s2.P101   0  8  0.7668
s1.K96    s2.L147   0  8  0.5171
s2.F171   s1.G134   0  8  0.5161
s1.K96    s2.L151   0  8  0.5187
s2.P101   s1.R110   0  8  0.7081
s2.P101   s1.E113   0  8  0.6438
s2.G56    s2.D40    0  8  0.6428
s2.P101   s1.I114   0  8  0.6803
s1.R209   s1.R95    0  8  0.3052
s2.T26    s2.L57    0  8  0.0871
s2.S160   s2.S32    0  8  0.0861
s2.E51    s2.Q4     0  8  0.6579
s1.L138   s1.L85    0  8  0.0925
s1.L138   s1.L112   0  8  0.3136
s1.E60    s1.R125   0  8  0.3126
s1.L138   s1.C226   0  8  0.7026
s1.L138   s1.C229   0  8  0.3828
s1.L138   s1.L230   0  8  0.4815
s2.V87    s2.P52    0  8  0.4805
s1.L138   s1.I233   0  8  0.6461
s1.L135   s1.I233   0  8  0.2748
s1.L135   s1.G239   0  8  0.0404
s2.F171   s1.F302   0  8  0.0394
s1.L135   s1.M242   0  8  0.2693
s1.L135   s1.V243   0  8  0.2541
s1.L135   s1.H246   0  8  0.9158
s1.I285   s1.R110   0  8  0.9148
s1.L135   s1.A249   0  8  0.5338
s1.N45    s1.I121   0  8  0.2170
s1.N45    s1.N235   0  8  0.9219
s2.T127   s2.T37    0  8  0.9209
s1.N45    s1.Y236   0  8  0.1072
s1.N45    s2.R68    0  8  0.5457
s1.N42    s1.I121   0  8  0.6458
s2.E93    s1.D313   0  8  0.6448
s2.P36    s2.A61    0  8  0.8949
s2.P36    s2.Q63    0  8  0.8671
s1.V295   s1.T150   0  8  0.2093
s2.E51    s1.V74    0  8  0.2083
s1.V295   s1.L255   0  8  0.4202
s1.G281   s1.M244   0  8  0.7568
s1.G280   s1.M244   0  8  0.8095
s1.N76    s1.V278   0  8  0.8085
s1.N376   s1.N327   0  8  0.2531
s1.N376   s1.V330   0  8  0.7404
s1.N376   s1.H331   0  8  0.6777
s1.M44    s2.P141   0  8  0.6767
s1.W63    s1.E34    0  8  0.3323
s1.W63    s1.F37    0  8  0.8687
s1.M323   s1.L366   0  8  0.4682
s1.D221   s1.C226   0  8  0.4672
s1.M323   s1.Q369   0  8  0.3455
s1.M323   s1.I370   0  8  0.5383
s1.M323   s1.Y373   0  8  0.4640
s2.R70    s2.Y53    0  8  0.4630
s1.R339   s1.F378   0  8  0.5531
s1.M242   s1.L128   0  8  0.0457
s1.M242   s1.L135   0  8  0.1823
s1.V368   s2.N94    0  8  0.1813
s1.M244   s1.V275   0  8  0.6693
s1.M244   s1.V278   0  8  0.1167
s1.M244   s1.G280   0  8  0.2879
s1.I370   s1.Y344   0  8  0.2869
s1.M244   s1.G281   0  8  0.8607
s1.M244   s1.I284   0  8  0.6666
s2.T54    s2.M3     0  8  0.9987
s1.D356   s2.T127   0  8  0.9977
s2.T54    s2.Q4     0  8  0.1542
s2.T54    s2.T5     0  8  0.2712
s2.T54    s2.I6     0  8  0.2284
s2.R70    s1.L257   0  8  0.2274
s2.Q136   s1.I316   0  8  0.8045
s2.Q136   s2.P89    0  8  0.8764
s1.C276   s1.F325   0  8  0.2459
s1.N76    s2.H106   0  8  0.2449
s1.C276   s1.I328   0  8  0.4059
s1.C276   s1.V329   0  8  0.0139
s1.C276   s1.S332   0  8  0.2596
s1.A38    s1.K357   0  8  0.2586
s1.P78    s1.S115   0  8  0.4286
s1.P78    s1.W123   0  8  0.1554
s1.P78    s1.E126   0  8  0.6167
s1.E34    s1.E298   0  8  0.6157
s1.P78    s1.F127   0  8  0.3262
s1.P78    s1.N132   0  8  0.4718
s1.P78    s1.G134   0  8  0.0504
s1.P247   s1.I39    0  8  0.0494
s1.L349   s1.Q300   0  8  0.4349
s1.L349   s1.F302   0  8  0.0544
s1.L349   s1.E303   0  8  0.2003
s1.R231   s2.T110   0  8  0.1993
s1.L349   s1.M306   0  8  0.6358
s1.P77    s1.E126   0  8  0.8799
s2.N134   s1.I316   0  8  0.6630
s1.M244   s1.L230   0  8  0.6620
s2.N134   s1.E362   0  8  0.4156
s2.N134   s1.S363   0  8  0.3596
s2.N134   s1.K365   0  8  0.9719
s1.E35    s2.E97    0  8  0.9709
s2.S85    s2.D13    0  8  0.0177
s2.S85    s2.A15    0  8  0.0239
s2.S85    s2.V16    0  8  0.8451
s1.F289   s1.M44    0  8  0.8441
s2.S85    s2.G17    0  8  0.6831
s2.S85    s2.G116   0  8  0.6207
s2.S85    s2.T117   0  8  0.0774
s1.E334   s1.M306   0  8  0.0764
s2.S85    s2.Q118   0  8  0.2692
s2.S85    s2.L121   0  8  0.1857
s2.S88    s2.D13    0  8  0.0864
s2.T37    s1.N337   0  8  0.0854
s2.S88    s2.V16    0  8  0.9911
s2.S88    s2.Q118   0  8  0.1520
s2.F80    s2.C8     0  8  0.1297
s2.K109   s1.L128   0  8  0.1287
s2.F80    s2.V9     0  8  0.4044
s2.F80    s2.V10    0  8  0.3013
s2.F80    s2.V11    0  8  0.0029
s2.G166   s1.Y344   0  8  0.0019
s2.F80    s2.C107   0  8  0.7863
s2.F80    s2.T110   0  8  0.5827
s2.F80    s2.P111   0  8  0.6358
s1.E104   s1.Y373   0  8  0.6348
s2.F80    s2.F112   0  8  0.1056
s2.F80    s2.L113   0  8  0.1344
s1.K348   s1.Q300   0  8  0.1247
s2.F171   s1.Y238   0  8  0.1237
s1.I316   s1.S363   0  8  0.2073
s1.I316   s1.K365   0  8  0.4051
s1.I316   s1.L366   0  8  0.2843
s2.L121   s2.G116   0  8  0.2833
s1.I316   s2.N134   0  8  0.9717
s1.I316   s2.K135   0  8  0.0879
s1.I316   s2.Q136   0  8  0.7006
s1.I82    s2.G14    0  8  0.6996
s1.V223   s1.L142   0  8  0.1799
s1.V223   s1.A145   0  8  0.1450
s1.V223   s1.Q146   0  8  0.6781
s1.I227   s1.N261   0  8  0.6771
s1.V223   s1.V149   0  8  0.5248
s1.V223   s1.S256   0  8  0.2639
s1.V223   s1.N259   0  8  0.5502
s1.T118   s2.L57    0  8  0.5492
s1.V223   s1.T264   0  8  0.9803
s1.I253   s1.I227   0  8  0.7958
s1.I253   s1.A288   0  8  0.1263
s2.A177   s2.I48    0  8  0.1253
s1.L53    s2.V38    0  8  0.6975
s1.V225   s1.T106   0  8  0.9650
s1.V225   s1.L109   0  8  0.0906
s2.N41    s2.N169   0  8  0.0896
s1.V225   s1.R110   0  8  0.4691
s1.V225   s1.E113   0  8  0.2471
s1.V340   s1.F378   0  8  0.4888
s2.S73    s2.R149   0  8  0.4878
s1.E252   s1.V139   0  8  0.6980
s1.E252   s1.L142   0  8  0.7409
s1.E252   s1.S143   0  8  0.7141
s1.L305   s1.E362   0  8  0.7131
s1.E252   s1.Q146   0  8  0.4450
s2.D13    s2.G62    0  8  0.5835
s2.D13    s2.C83    0  8  0.6289
s2.K29    s2.S126   0  8  0.6279
s2.D13    s2.F84    0  8  0.0281
s2.D13    s2.S85    0  8  0.1185
s2.D13    s2.S88    0  8  0.0401
s1.W63    s2.A178   0  8  0.0391
s2.D13    s2.S90    0  8  0.6271
s2.D13    s2.S91    0  8  0.8922
s2.D13    s2.N94    0  8  0.6862
s1.K86    s1.L351   0  8  0.6852
s2.L179   s2.I6     0  8  0.5585
s2.L179   s2.I48    0  8  0.7600
s1.L351   s1.M306   0  8  0.7745
s1.E362   s1.T94    0  8  0.7735
s1.L351   s1.I326   0  8  0.6705
s1.F318   s1.P262   0  8  0.0252
s1.F318   s1.R263   0  8  0.2991
s1.N251   s2.A61    0  8  0.2981
s1.F318   s1.K265   0  8  0.8511
s1.F318   s1.A266   0  8  0.1501
s1.F318   s1.L269   0  8  0.2948
s2.A161   s2.D59    0  8  0.2938
s2.L176   s2.I48    0  8  0.8884
s2.C83    s2.V10    0  8  0.3114
s2.C83    s2.V11    0  8  0.3163
s1.V40    s1.Q300   0  8  0.3153
s2.C83    s2.G12    0  8  0.1648
s2.C83    s2.D13    0  8  0.7098
s2.C83    s2.V16    0  8  0.1662
s2.N134   s2.R70    0  8  0.1652
s2.C83    s2.G17    0  8  0.1222
s2.C83    s2.K18    0  8  0.1894
s2.C83    s2.L21    0  8  0.3611
s1.L89    s2.G12    0  8  0.3601
s2.C83    s2.V115   0  8  0.8381
s2.C83    s2.G116   0  8  0.5888
s2.C83    s2.T117   0  8  0.6888
s2.F112   s1.D375   0  8  0.6878
s2.R68    s1.A43    0  8  0.1420
s2.R68    s1.M44    0  8  0.6373
s2.R68    s1.N45    0  8  0.4172
s1.V268   s2.V10    0  8  0.4162
s2.R68    s1.R117   0  8  0.4305
s2.R68    s1.T118   0  8  0.4450
s2.R68    s1.N119   0  8  0.1829
s2.E180   s1.V377   0  8  0.1819
s2.R68    s1.H120   0  8  0.0881
s2.R68    s1.I121   0  8  0.5058
s2.A148   s1.Q146   0  8  0.9114
s1.L257   s1.R100   0  8  0.9104
s2.A148   s1.Y147   0  8  0.0314
s2.A148   s1.A148   0  8  0.6444
s2.A148   s1.V149   0  8  0.3245
s1.H224   s1.L257   0  8  0.3235
s2.A148   s1.T150   0  8  0.7270
s2.A148   s1.F151   0  8  0.4058
s2.A148   s1.L211   0  8  0.0994
s1.V295   s2.T104   0  8  0.0984
s2.A148   s1.S214   0  8  0.3728
s2.A148   s1.R215   0  8  0.9147
s2.A148   s1.S218   0  8  0.9942
s1.K75    s1.A288   0  8  0.9932
s2.A148   s2.L114   0  8  0.8021
s2.P89    s2.L131   0  8  0.3249
s2.P89    s2.Q136   0  8  0.5873
s1.V225   s2.E102   0  8  0.5863
s2.P89    s2.K137   0  8  0.2347
s2.P89    s2.I139   0  8  0.9267
s1.L211   s1.Y147   0  8  0.6298
s2.V38    s2.S85    0  8  0.6288
s1.L211   s1.A148   0  8  0.0577
s1.R71    s2.L72    0  8  0.2745
s1.R71    s2.P75    0  8  0.7393
s1.L305   s1.H224   0  8  0.7383
s1.V124   s1.A232   0  8  0.0593
s1.V124   s1.I233   0  8  0.0065
s1.V124   s1.Y236   0  8  0.2437
s1.R208   s1.I66    0  8  0.2427
s1.V124   s1.G239   0  8  0.4149
s2.C159   s2.L21    0  8  0.5122
s2.C159   s2.V115   0  8  0.6311
s2.R122   s1.N327   0  8  0.6301
s2.C159   s2.G116   0  8  0.1765
s2.C159   s2.T117   0  8  0.7029
s2.C159   s2.I119   0  8  0.4525
s2.Q76    s1.A145   0  8  0.4515
s1.N119   s1.V74    0  8  0.2862
s1.N119   s2.R68    0  8  0.5802
s1.N119   s2.P71    0  8  0.8240
s2.A177   s1.L54    0  8  0.8230
s2.K135   s1.N314   0  8  0.3807
s2.K135   s1.N315   0  8  0.9358
s2.K135   s1.I316   0  8  0.3692
s1.D379   s1.F346   0  8  0.3682
s2.K135   s1.S363   0  8  0.1074
s2.K137   s2.P89    0  8  0.8089
s2.K133   s1.I82    0  8  0.0998
s1.N376   s2.P52    0  8  0.0988
s2.K133   s1.N129   0  8  0.3650
s2.K133   s1.E130   0  8  0.3620
s2.K133   s1.E131   0  8  0.3690
s1.V108   s1.I39    0  8  0.3680
s2.K133   s1.N132   0  8  0.7035
s2.K133   s1.K133   0  8  0.8893
s2.K133   s1.G134   0  8  0.2268
s2.C159   s1.K304   0  8  0.2258
s2.K133   s1.L135   0  8  0.8981
s2.K133   s1.D136   0  8  0.5628
s2.K133   s1.V137   0  8  0.4900
s2.P141   s1.E312   0  8  0.4890
s2.K133   s1.E362   0  8  0.5367
s2.K133   s1.S363   0  8  0.9607
s2.K133   s1.D364   0  8  0.6308
s1.M306   s1.Q103   0  8  0.6298
s2.A61    s2.G14    0  8  0.2100
s2.A61    s2.P36    0  8  0.9239
s2.A61    s2.T37    0  8  0.9850
s1.M336   s1.N251   0  8  0.9840
s2.T60    s2.V9     0  8  0.7980
s2.T60    s2.V10    0  8  0.7156
s2.T60    s2.V11    0  8  0.8551
s2.T45    s1.D222   0  8  0.8541
s2.T60    s2.G12    0  8  0.6924
s2.T60    s2.K18    0  8  0.8054
s1.N235   s1.N45    0  8  0.6533
s2.A161   s1.L65    0  8  0.6523
s1.N235   s1.R117   0  8  0.2944
s2.P71    s1.F72    0  8  0.0013
s2.P71    s1.T118   0  8  0.2270
s1.R55    s1.K359   0  8  0.2260
s2.P71    s1.N119   0  8  0.0606
s2.P71    s2.E102   0  8  0.7041
s2.P71    s2.H106   0  8  0.0178
s2.R122   s2.I139   0  8  0.0168
s2.P75    s1.R71    0  8  0.4941
s2.P75    s1.F72    0  8  0.0643
s2.P75    s1.Q73    0  8  0.8335
s1.N259   s2.K146   0  8  0.8325
s2.P75    s2.C107   0  8  0.7718
s1.Y236   s1.N45    0  8  0.8796
s1.Y236   s1.I121   0  8  0.5201
s2.R68    s1.A145   0  8  0.5191
s1.Y236   s1.V124   0  8  0.2946
s1.Y238   s1.R125   0  8  0.0597
s1.Y238   s1.L128   0  8  0.5087
s2.P31    s1.E334   0  8  0.5077
s2.C8     s2.L55    0  8  0.7667
s2.C8     s2.G56    0  8  0.9978
s2.C8     s2.L57    0  8  0.7040
s1.R301   s2.R122   0  8  0.7030
s2.C8     s2.F58    0  8  0.5850
s2.C8     s2.T77    0  8  0.2211
s2.C8     s2.D78    0  8  0.6601
s1.I114   s1.Q237   0  8  0.6591
s2.C8     s2.V79    0  8  0.7255
s2.C8     s2.F80    0  8  0.6834
s2.C8     s2.L81    0  8  0.6082
s2.V11    s1.L286   0  8  0.6072
s2.C8     s2.F171   0  8  0.7973
s2.C8     s2.A174   0  8  0.8767
s2.C8     s2.A178   0  8  0.8407
s2.K7     s1.Q324   0  8  0.8397
s1.N76    s1.E111   0  8  0.8691
s1.N76    s1.S115   0  8  0.5436
s2.V115   s2.L21    0  8  0.7871
s1.Q146   s1.D58    0  8  0.7861
s2.V115   s2.L81    0  8  0.8913
s2.V115   s2.V82    0  8  0.7068
s2.V115   s2.C83    0  8  0.3335
s2.L114   s1.D90    0  8  0.3325
s2.V115   s2.F84    0  8  0.6746
s2.V115   s2.V157   0  8  0.7812
s2.V115   s2.E158   0  8  0.7715
s1.F144   s1.A43    0  8  0.7705
s2.V115   s2.C159   0  8  0.8651
s2.V115   s2.V170   0  8  0.1992
s1.L269   s1.F318   0  8  0.3733
s1.V74    s2.E158   0  8  0.3723
s1.L269   s1.A321   0  8  0.9413
s1.L269   s1.S322   0  8  0.8133
s1.L269   s1.Q324   0  8  0.0050
s1.R117   s2.P71    0  8  0.0040
s1.L269   s1.F325   0  8  0.1395
s1.L267   s1.H224   0  8  0.3774
s1.L267   s1.I227   0  8  0.4254
s2.E180   s1.V108   0  8  0.4244
s1.L267   s1.M228   0  8  0.4553
s1.L267   s1.R231   0  8  0.0756
s1.L267   s1.A321   0  8  0.0962
s2.A132   s1.A288   0  8  0.0952
s1.L142   s1.V223   0  8  0.9335
s1.L142   s1.C226   0  8  0.4892
s1.L142   s1.I227   0  8  0.5975
s1.P78    s2.R165   0  8  0.5965
s1.L142   s1.L230   0  8  0.8736
s1.L142   s1.E252   0  8  0.4695
s1.L142   s1.S256   0  8  0.2561
s1.V40    s1.S332   0  8  0.2551
s1.K304   s1.L257   0  8  0.7686
s1.K304   s1.N258   0  8  0.8369
s2.E64    s1.E60    0  8  0.6437
s2.Q136   s2.T110   0  8  0.6427
s2.E64    s1.K61    0  8  0.4313
s2.E64    s1.K62    0  8  0.9544
s2.E64    s1.W63    0  8  0.0036
s1.K84    s2.Q164   0  8  0.0026
s2.E64    s1.E64    0  8  0.9533
s2.E64    s1.L65    0  8  0.4720
s2.E64    s1.I66    0  8  0.9249
s2.L147   s2.D124   0  8  0.9239
s2.E64    s1.C67    0  8  0.5580
s2.E64    s1.D68    0  8  0.2470
s2.E173   s2.L113   0  8  0.4268
s2.K155   s2.A15    0  8  0.4258
s1.I82    s1.F127   0  8  0.4799
s1.I82    s1.N132   0  8  0.4245
s1.I82    s1.K133   0  8  0.8299
s1.Y238   s2.N169   0  8  0.8289
s1.I82    s1.G134   0  8  0.1123
s1.I82    s1.V137   0  8  0.6604
s2.D59    s2.V10    0  8  0.1166
s1.T106   s2.C20    0  8  0.1156
s2.D59    s2.K18    0  8  0.0008
s2.D59    s2.T19    0  8  0.7617
s2.D59    s2.L22    0  8  0.9052
s2.V86    s2.P36    0  8  0.9042
s2.E97    s1.M228   0  8  0.1728
s2.S73    s1.D68    0  8  0.6784
s2.S73    s2.V9     0  8  0.6747
s2.S126   s1.N311   0  8  0.6737
s2.S73    s2.F39    0  8  0.6094
s2.E93    s1.R263   0  8  0.1315
s2.M3     s2.P52    0  8  0.1682
s1.N235   s1.K265   0  8  0.1672
s2.M3     s2.Y53    0  8  0.0803
s2.M3     s2.T54    0  8  0.8927
s1.E111   s1.K75    0  8  0.9790
s2.C107   s2.G62    0  8  0.9780
s1.E111   s1.N76    0  8  0.0467
s1.E111   s1.Y81    0  8  0.2281
s1.E111   s2.H105   0  8  0.8226
s1.F338   s1.L342   0  8  0.8216
s1.Q343   s1.V377   0  8  0.8308
s1.Q343   s1.F378   0  8  0.0303
s2.W99    s2.V11    0  8  0.3372
s1.N291   s2.F84    0  8  0.3362
s2.W99    s2.G12    0  8  0.2732
s1.I328   s1.A273   0  8  0.5604
s1.I328   s1.C276   0  8  0.1468
s1.D364   s2.Q136   0  8  0.1458
s1.I328   s1.L277   0  8  0.5370
s1.A266   s1.N315   0  8  0.4285
s1.A266   s1.D317   0  8  0.2527
s1.E312   s1.F309   0  8  0.2517
s1.A266   s1.F318   0  8  0.0493
s1.A266   s1.V320   0  8  0.9514
s1.A266   s1.A321   0  8  0.1720
s1.A321   s2.F80    0  8  0.1710
s1.Q69    s1.V40    0  8  0.1642
s1.Q69    s1.A43    0  8  0.0106
s1.Q69    s2.L72    0  8  0.5465
s2.G56    s1.N259   0  8  0.5455
s2.A153   s2.V82    0  8  0.4218
s2.A153   s2.V100   0  8  0.4332
s2.A153   s2.F112   0  8  0.9911
s1.K357   s1.Y236   0  8  0.9901
s2.A153   s2.L113   0  8  0.9215
s2.A153   s2.L114   0  8  0.7475
s1.I326   s1.L351   0  8  0.5440
s2.I119   s2.A61    0  8  0.5430
s1.I326   s1.Y373   0  8  0.2820
s1.V275   s1.V243   0  8  0.5275
s1.V275   s1.M244   0  8  0.9206
s2.V87    s2.Y34    0  8  0.9196
s1.V275   s1.V250   0  8  0.5456
s1.E362   s2.A132   0  8  0.3986
s1.E362   s2.K133   0  8  0.2608
s2.Y156   s1.M228   0  8  0.2598
s1.E362   s2.N134   0  8  0.5654
s1.V278   s1.F240   0  8  0.5642
s1.V278   s1.M244   0  8  0.0175
s1.H79    s1.A51    0  8  0.0165
s1.Y141   s1.L85    0  8  0.1774
s1.Y141   s1.Y88    0  8  0.4283
s1.Y141   s1.L89    0  8  0.1799
s2.T54    s1.D290   0  8  0.1789
s1.Y141   s1.D222   0  8  0.6270
s1.Y141   s1.C226   0  8  0.5550
s1.Y147   s1.T210   0  8  0.0632
s1.V250   s1.V108   0  8  0.0622
s1.Y147   s1.L211   0  8  0.5636
s1.Y147   s1.S214   0  8  0.9190
s1.Y147   s1.S218   0  8  0.9945
s2.P36    s1.K50    0  8  0.9935
s1.V377   s1.Q343   0  8  0.3098
s1.R36    s1.I66    0  8  0.9945
s1.A321   s1.K265   0  8  0.4462
s1.L46    s1.K86    0  8  0.4452
s1.A321   s1.A266   0  8  0.2028
s1.A321   s1.L267   0  8  0.9626
s1.A321   s1.L269   0  8  0.7522
s1.L46    s1.Q73    0  8  0.7512
s1.A321   s1.E270   0  8  0.6942
s1.A321   s1.A273   0  8  0.4197
s2.V10    s2.L57    0  8  0.9463
s1.F378   s1.T347   0  8  0.9453
s2.V10    s2.F58    0  8  0.8296
s2.V10    s2.D59    0  8  0.6696
s2.V10    s2.T60    0  8  0.2721
s2.E64    s1.N59    0  8  0.2711
s2.V10    s2.F80    0  8  0.1136
s2.V10    s2.L81    0  8  0.4578
s2.V10    s2.C83    0  8  0.5928
s2.C107   s1.I233   0  8  0.5918
s1.T264   s1.V223   0  8  0.1823
s1.T264   s1.H224   0  8  0.3873
s1.T264   s1.I227   0  8  0.4380
s1.L355   s2.D67    0  8  0.4370
s1.I227   s1.L142   0  8  0.4062
s1.I227   s1.I253   0  8  0.2018
s1.I227   s1.S256   0  8  0.5111
s1.R310   s1.K96    0  8  0.5101
s1.I227   s1.T264   0  8  0.9416
s1.I227   s1.L267   0  8  0.2825
s1.I227   s1.V268   0  8  0.0039
s2.L147   s2.S32    0  8  0.0029
s1.I227   s1.L271   0  8  0.7679
s1.F346   s1.F302   0  8  0.8552
s1.F346   s1.M306   0  8  0.0845
s2.V170   s2.T140   0  8  0.0835
s2.L121   s2.S85    0  8  0.6645
s2.L121   s2.V86    0  8  0.9062
s2.L121   s2.V87    0  8  0.4062
s1.L255   s1.V368   0  8  0.4052
s1.R117   s1.M228   0  8  0.9978
s1.R117   s1.A232   0  8  0.5775
s1.R117   s1.N235   0  8  0.4059
s1.L277   s1.W63    0  8  0.4049
s1.R117   s2.D67    0  8  0.1247
s1.R117   s2.R68    0  8  0.8978
s1.R110   s1.V225   0  8  0.9182
s1.L53    s1.M323   0  8  0.9172
s1.R110   s2.P101   0  8  0.6430
s1.R110   s2.H105   0  8  0.2412
s1.H308   s1.L257   0  8  0.8236
s1.G280   s2.I139   0  8  0.8226
s1.H308   s1.K265   0  8  0.0202
s2.K98    s2.G12    0  8  0.9044
s2.V16    s2.G62    0  8  0.2621
s1.F289   s2.L151   0  8  0.2611
s2.V16    s2.C83    0  8  0.4607
s2.V16    s2.F84    0  8  0.4405
s2.V16    s2.S85    0  8  0.6711
s1.L65    s1.L355   0  8  0.6701
s2.V16    s2.S88    0  8  0.6828
s2.V16    s2.S91    0  8  0.7291
s2.V16    s2.T117   0  8  0.2577
s1.N291   s2.R165   0  8  0.2567
s2.V16    s2.Q118   0  8  0.1784
s2.V11    s2.T60    0  8  0.3887
s2.V11    s2.G62    0  8  0.2771
s2.P108   s2.P141   0  8  0.2761
s2.V11    s2.R70    0  8  0.3576
s2.V11    s2.F80    0  8  0.9208
s2.V11    s2.L81    0  8  0.0083
s1.D379   s2.A144   0  8  0.0073
s2.V11    s2.V82    0  8  0.0030
s2.V11    s2.C83    0  8  0.5807
s2.V11    s2.W99    0  8  0.5034
s1.C229   s1.V340   0  8  0.5024
s2.V11    s2.E102   0  8  0.7025
s2.V11    s2.I103   0  8  0.0495
s1.S143   s1.H248   0  8  0.9244
s2.C159   s2.A148   0  8  0.9234
s1.S143   s1.E252   0  8  0.9103
s1.S143   s1.L255   0  8  0.0242
s2.D124   s2.V87    0  8  0.2592
s1.R52    s2.E102   0  8  0.2582
s1.V74    s1.S115   0  8  0.3763
s1.V74    s1.N119   0  8  0.4957
s1.V74    s1.H120   0  8  0.8940
s2.V35    s1.S245   0  8  0.8930
s1.V74    s1.W123   0  8  0.4274
s1.K84    s1.V108   0  8  0.1983
s1.K86    s1.V137   0  8  0.2422
s2.I23    s1.M244   0  8  0.2412
s1.R231   s1.L267   0  8  0.1066
s1.R231   s1.E270   0  8  0.6413
s1.R231   s1.L271   0  8  0.7692
s2.T127   s1.Q300   0  8  0.7682
s2.F171   s2.C8     0  8  0.3363
s2.F171   s2.Y25    0  8  0.6562
s2.F171   s2.L55    0  8  0.0470
s1.R36    s1.E303   0  8  0.0460
s1.E113   s1.V225   0  8  0.7052
s1.E113   s1.M228   0  8  0.4622
s1.E113   s1.C229   0  8  0.0900
s1.A43    s2.K109   0  8  0.0890
s1.E113   s1.A232   0  8  0.5825
s1.E113   s2.P101   0  8  0.5449
s2.K168   s2.Y25    0  8  0.5302
s2.K18    s2.Y156   0  8  0.5292
s2.P111   s2.D78    0  8  0.3769
s2.P111   s2.V79    0  8  0.9906
s2.P111   s2.F80    0  8  0.8583
s1.D58    s2.H105   0  8  0.8573
s2.P111   s2.V154   0  8  0.5103
s2.P111   s2.A177   0  8  0.2149
s2.P111   s2.A178   0  8  0.6860
s1.G134   s2.T110   0  8  0.6850
s2.P111   s2.E180   0  8  0.8634
s1.E126   s1.P77    0  8  0.8901
s1.E126   s1.P78    0  8  0.4448
s2.K18    s1.K219   0  8  0.4438